Exfoliating Mask

$75

check 1

product.tags = beautybrand_Joanna VargasexfoliantexfoliateExfoliatorface maskjoannavargasmaskmasksskincaretype_Exfoliantstype_Masksundefinedwellnesswomen-at-the-helm

size_chart_page =

wishlist

size_chart_page.handle =

Gently scrub away impurities with this enzyme-rich exfoliating mask.

To Use
Apply a thin layer to cleansed and dampened skin. Scrub gently for one minute or leave on as a mask for 15 minutes. Rinse with tepid water.

Size
1.69 fl oz / 50 ml

Ingredients
Water (Aqua), Kaolin Clay, Pumice (Volcanic Rock), Glycerin (vegetable derived), Saccharum Officinarum (Sugar Cane) Extract, Vaccinium Myrtillus (Bilberry) Extract, Citrus Aurantium Dulcis (Orange) Fruit Extract, Acer Saccharinum (Sugar Maple) Extract, Citrus Medica Limonum (Lemon) Fruit Extract, Mica, Titanium Dioxide, Iron Oxide, Polysorbate 80, Phenoxyethanol

The Helm accepts returns of unopened/unused products in resellable condition. Products must be returned with all original tags attached, in their original packaging. Returns must be initiated and mailed back by the customer within 14 days of delivery date.

View our full return policy

The following brands are non-returnable:

  • Activist Manuka
  • Brightland
  • Dame
  • GEM Vitamins
  • GOLDE
  • ILA
  • Inner Piece
  • KOLLO
  • Lunette
  • Michele Varian
  • Natalist
  • NOTO botanics
  • Palermo Body
  • PRNCPLS
  • The Cristalline
  • Une Hueres
  • Wellflower
  • WMS &Co.
  • Wooden Spoon Herbs

Recently Viewed